PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1932_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 339aa    MW: 38474.3 Da    PI: 7.5565
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1932_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.75.8e-14257308556
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                 +r+rr++kNRe+A rsR+R++a++ eLe +  +L++eN++Lkk +ee  k+ 
  RrC1932_p2 257 RRQRRMIKNRESAARSRARRQAYTVELELELNQLTEENMKLKKIVEENDKKR 308
                 79*****************************************999876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-11250326IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714255303IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.56E-9257304No hitNo description
PfamPF001709.0E-12257310IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.1E-12257308No hitNo description
PROSITE patternPS000360260275IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MPIPESETST FHVFNHNLQT QPQTFPQETA VEEHPPVGRQ NSIMSLTLDE IQMKSGKSFG  60
AMNMDELLAN MWMTVEENNN VGGAGGHQNG EKPTVLPRQG SLSVPVPLCK KTVEEVWFEI  120
QNGAVQQPPP PSSSIAGQNP DEDNRRQQTL GEITLEDFLV KAGVVQEPLK TTTMKMSSSD  180
FGYNPEFGVG LHCQTQNNYG DNNRTVYSEN RPFYSGIGES SSCMTGNGRS EQYLTGLNAF  240
RIQKRIIDGP PEILMERRQR RMIKNRESAA RSRARRQAYT VELELELNQL TEENMKLKKI  300
VEENDKKRRQ ELMNRSIQIT KEKNGEKLRR IRRMASTGW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150300.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
RefseqXP_009150299.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RYD60.0AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A078F7P70.0A0A078F7P7_BRANA; BnaCnng04010D protein
STRINGBra019436.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.11e-170bZIP family protein